Example

>B1XBY6
MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKSDQNVR
GATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGEMNFDVVIASPDA
MRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDF
DADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
>E9Q5L3
MAVSALQLWRMGGLLRRRFPTCLSPWKIPPRVLKSSQPEALVSLTNNAVAFAPLQTLTDE
EIMMKQTVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFC
SVLVIEELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAG
AGSDSFAMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRD
TEGFQIGKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQ
MLGLAQGCFDYTIPYIKERMQFGKRIFDFQGLQHQVAQVATQLEATRLLTYNAARLVEAG
RPFIKEASMAKYYASEVAGLTTSKCIEWMGGVGYTKDYPVEKFFRDAKIGKQAFHGLLFY
LPLWVFGLLCLSILYYCYLGKSILISTECLLTFRGWISSFFLSEK

 

NOTE:
(1) Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.

(2) Each Upload File Size must less than 100K .Please contact Yan Xu if your file is larger than 100K.

(3) Theaccepted characters are: A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V,W, Y, and the dummy code X. If the query sequence contains any illegalcharacters, the prediction will be stopped .

Close