Example

>P49006(example 1)
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPS
GPESGPTPASAEQNE
>P60174(example 2)
MAEDGEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLG
ELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGM
IKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKV
VFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ
STRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

 

NOTE:
(1) Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.

(2) Theaccepted characters are: A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, and the dummy code X. If the query sequence contains any illegal characters, the prediction will be stopped .

Close